PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00374.1_g00017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 249aa    MW: 28857.1 Da    PI: 10.3986
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00374.1_g00017.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69e-161762147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             rg W + Ed+ l ++v+q+G+++W+ Ia+++  gR++k+c++rw++ 
  Rsa1.0_00374.1_g00017.1 17 RGHWRPIEDDHLRQLVEQYGPKNWNFIAQHLY-GRSGKSCRLRWYNQ 62
                             899****************************9.************96 PP

2Myb_DNA-binding58.51.5e-1869112146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              ++++T+eE+e+l++a++ +G++ W++Iar ++ gRt++ +k++++ 
  Rsa1.0_00374.1_g00017.1  69 KKPFTEEEEERLLQAHRFHGNR-WASIARLFP-GRTDNAVKNHFHV 112
                              689*******************.*********.**********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2441263IPR017930Myb domain
SMARTSM007176.0E-131665IPR001005SANT/Myb domain
SuperFamilySSF466893.67E-2916110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-251870IPR009057Homeodomain-like
CDDcd001677.51E-122061No hitNo description
PfamPF139211.7E-162080No hitNo description
PROSITE profilePS5129423.95364118IPR017930Myb domain
SMARTSM007171.9E-1568116IPR001005SANT/Myb domain
CDDcd001671.18E-1171111No hitNo description
Gene3DG3DSA:1.10.10.608.3E-2171116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MSRGSSSFDN KKISCQRGHW RPIEDDHLRQ LVEQYGPKNW NFIAQHLYGR SGKSCRLRWY  60
NQLDPNITKK PFTEEEEERL LQAHRFHGNR WASIARLFPG RTDNAVKNHF HVIMARRKRE  120
SSSSTATSTF NQSWHNILSH SSSLTRQNRS QFGLWTYQNN KSRGLWPYTF VPARKDDQLG  180
SSSISYLHKD IYPERRKSTE LVDHHNYALH AGKPDHKKNS SSEDGPSMGD DGGKRNVTFI  240
DFLGVGLVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-34171174104MYB PROTO-ONCOGENE PROTEIN
1msf_C3e-34171174104C-Myb DNA-Binding Domain
1mse_C3e-34171174104C-Myb DNA-Binding Domain
1h89_C1e-331711758158MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-331711758158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013654203.11e-164PREDICTED: transcriptional activator Myb-like
TrEMBLA0A078GT241e-163A0A078GT24_BRANA; BnaC03g66570D protein
STRINGBra034565.1-P1e-162(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101332036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33450.11e-150myb domain protein 69